THI4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: THI4_ARATH
• UniProt AC: Q38814
• Protein Name: Thiamine thiazole synthase, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}
• Gene Name: THI1 {ECO:0000255|HAMAP-Rule:MF_03158}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 349
• Subcellular Localization: Plastid, chloroplast . Mitochondrion . Cell membrane .
• Protein Description: Involved in biosynthesis of the thiamine precursor thiazole. Catalyzes the conversion of NAD and glycine to adenosine diphosphate 5-(2-hydroxyethyl)-4-methylthiazole-2-carboxylic acid (ADT), an adenylated thiazole intermediate. The reaction includes an iron-dependent sulfide transfer from a conserved cysteine residue of the protein to a thiazole intermediate. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme. May have additional roles in adaptation to various stress conditions and in DNA damage tolerance. Acts as a positive regulator for the abscisic acid-induced activation of slow type anion channels during stomatal closure by repressing CPK33 kinase activity..
• Protein Sequence: MAAIASTLSLSSTKPQRLFDSSFHGSAISAAPISIGLKPRSFSVRATTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPELVLAAADSAETVDA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
167	Phosphorylation	KHAALFTSTIMSKLL EHHHHHHHHHHHHHH	14.49	22092075
216	Other	QNHHTQSCMDPNVME CCCCCCCCCCCCCCE	2.29	22031445
216	Hydroxylation	QNHHTQSCMDPNVME CCCCCCCCCCCCCCE	2.29	22031445
229	Phosphorylation	MEAKIVVSSCGHDGP CEEEEEEECCCCCCC	14.71	22092075
247	Phosphorylation	TGVKRLKSIGMIDHV CHHHHHHHCCCCCCC	29.03	25561503
250	Sulfoxidation	KRLKSIGMIDHVPGM HHHHHCCCCCCCCCC	2.87	25693801
257	Sulfoxidation	MIDHVPGMKALDMNT CCCCCCCCCCCCCCC	1.55	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of THI4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of THI4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of THI4_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of THI4_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.