CSN5B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CSN5B_ARATH
• UniProt AC: Q9FVU9
• Protein Name: COP9 signalosome complex subunit 5b
• Gene Name: CSN5B {ECO:0000303|PubMed:23424245}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 358
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex (By similarity). The CSN complex is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of PSIAA6 by regulating the activity of the Ubl ligase SCF-TIR complex. Not involved in CSN's deneddylation/derubylation activity. [PubMed: 15486099]
• Protein Sequence: MEGSSSTIARKTWELENSILTVDSPDSTSDNIFYYDDTSQTRFQQEKPWENDPHYFKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQDDAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQQHQEPFLAVVIDPTRTVSAGKVEIGAFRTYSKGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDVTYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESHLVQSRFGGVVPSSLHKKKEDESQLTKITRDSAKITVEQVHGLMSQVIKDELFNSMRQSNNKSPTDSSDPDPMITY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEGSSSTI -------CCCCCCHH	13.69	-
75	Phosphorylation	KMVVHARSGGTIEIM HHHHHHHCCCEEEEE	42.21	19880383
282	Phosphorylation	EKLEQAESHLVQSRF HHHHHHHHHHHHHHH	33.25	25368622
287	Phosphorylation	AESHLVQSRFGGVVP HHHHHHHHHHCCCCC	22.67	25368622

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CSN5B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CSN5B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CSN5B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CSN3_ARATH	COP13	physical	11684663
CSN1_ARATH	FUS6	physical	11684663
CSN1_ARATH	FUS6	physical	15486099
CSN2_ARATH	FUS12	physical	15486099
CSN3_ARATH	COP13	physical	15486099
CSN4_ARATH	COP8	physical	15486099
CSN7_ARATH	FUS5	physical	15486099
CSN8_ARATH	COP9	physical	15486099
CSN6A_ARATH	CSN6A	physical	15486099
RAC10_ARATH	RAC10	physical	21798944
VATF_ARATH	AT4G02620	physical	21798944
GAT24_ARATH	ZML1	physical	21798944
CSN8_ARATH	COP9	physical	21798944
TTL3_ARATH	TTL3	physical	21798944
TIM8_ARATH	TIM8	physical	21798944
RTL2_ARATH	RTL2	physical	21798944
MOS1_ARATH	MOS1	physical	21798944
SAR1A_ARATH	SAR2	physical	21798944
LOR15_ARATH	AT5G01750	physical	21798944
COL14_ARATH	AT2G33500	physical	21798944
ULT1_ARATH	ULT1	physical	21798944
GMPP1_ARATH	CYT1	physical	23424245
CSN6A_ARATH	CSN6A	physical	11742986
CSN6B_ARATH	CSN6B	physical	11742986
CSN8_ARATH	COP9	physical	11742986
CSN7_ARATH	FUS5	physical	11742986

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.