| UniProt ID | CSN3_ARATH | |
|---|---|---|
| UniProt AC | Q8W575 | |
| Protein Name | COP9 signalosome complex subunit 3 | |
| Gene Name | CSN3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 429 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of IAA6 by regulating the activity of the Ubl ligase SCF-TIR complex.. | |
| Protein Sequence | MIGAVNSVEAVITSIQGLSGSPEDLSALHDLLRGAQDSLRAEPGVNFSTLDQLDASKHSLGYLYFLEVLTCGPVSKEKAAYEIPIIARFINSCDAGQIRLASYKFVSLCKILKDHVIALGDPLRGVGPLLNAVQKLQVSSKRLTALHPDVLQLCLQAKSYKSGFSILSDDIVEIDQPRDFFLYSYYGGMICIGLKRFQKALELLYNVVTAPMHQVNAIALEAYKKYILVSLIHNGQFTNTLPKCASTAAQRSFKNYTGPYIELGNCYNDGKIGELEALVVARNAEFEEDKNLGLVKQAVSSLYKRNILRLTQKYLTLSLQDIANMVQLGNAKEAEMHVLQMIQDGQIHALINQKDGMVRFLEDPEQYKSSEMIEIMDSVIQRTIGLSKNLLAMDESLSCDPLYLGKVGRERQRYDFGDDFDTVPQKFSM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of CSN3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSN3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSN3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSN3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CSN1_ARATH | FUS6 | physical | 11684663 | |
| CSN5B_ARATH | CSN5B | physical | 11684663 | |
| CSN1_ARATH | FUS6 | physical | 12615944 | |
| CSN2_ARATH | FUS12 | physical | 12615944 | |
| CSN3_ARATH | COP13 | physical | 12615944 | |
| CSN4_ARATH | COP8 | physical | 12615944 | |
| CSN8_ARATH | COP9 | physical | 12615944 | |
| CSN6A_ARATH | CSN6A | physical | 12615944 | |
| CSN1_ARATH | FUS6 | physical | 23762492 | |
| CSN4_ARATH | COP8 | physical | 23762492 | |
| CSN5A_ARATH | CSN5A | physical | 23762492 | |
| CSN8_ARATH | COP9 | physical | 23762492 | |
| CSN8_ARATH | COP9 | physical | 11742986 | |
| CSN4_ARATH | COP8 | physical | 11742986 | |
| CSN5A_ARATH | CSN5A | physical | 11742986 | |
| CSN5B_ARATH | CSN5B | physical | 11742986 | |
| CSN7_ARATH | FUS5 | physical | 11742986 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
