| UniProt ID | CSN5A_ARATH | |
|---|---|---|
| UniProt AC | Q8LAZ7 | |
| Protein Name | COP9 signalosome complex subunit 5a | |
| Gene Name | CSN5A {ECO:0000303|PubMed:23424245} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 357 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex (By similarity). The CSN complex is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of PSIAA6 by regulating the activity of the Ubl ligase SCF-TIR complex. Involved in CSN's deneddylation/derubylation activity. [PubMed: 15486099 Required for the deneddylation of all cullins] | |
| Protein Sequence | MEGSSSAIARKTWELENNILPVEPTDSASDSIFHYDDASQAKIQQEKPWASDPNYFKRVHISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQSDAYEYMVEYSQTSKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGGIAPAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNSARQSKKSADDSSDPEPMITS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEGSSSAI -------CCCCCHHH | 13.69 | 22223895 | |
| 25 | Phosphorylation | NILPVEPTDSASDSI CEECCCCCCCCCCCC | 34.80 | 23572148 | |
| 35 | Phosphorylation | ASDSIFHYDDASQAK CCCCCCCCCCHHHHH | 9.15 | 19880383 | |
| 75 | Phosphorylation | KMVVHARSGGTIEIM HHHHHHHCCCEEEEE | 42.21 | 19880383 | |
| 348 | Phosphorylation | SKKSADDSSDPEPMI CCCCCCCCCCCCCCC | 49.91 | 25561503 | |
| 349 | Phosphorylation | KKSADDSSDPEPMIT CCCCCCCCCCCCCCC | 38.84 | 19880383 | |
| 354 | Sulfoxidation | DSSDPEPMITS---- CCCCCCCCCCC---- | 22.82 | 23289948 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSN5A_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSN5A_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSN5A_ARATH !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
