dbPTM

RAC10_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RAC10_ARATH
UniProt AC	O82481
Protein Name	Rac-like GTP-binding protein ARAC10
Gene Name	ARAC10
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	215
Subcellular Localization	Membrane Lipid-anchor. Cytoplasm. Cytoplasm, cytoskeleton. Recruited along cortical microtubules upon interaction with ICR5.
Protein Description	Involved in local disassembly of cortical microtubules when associated with ICR5 and KIN13A..
Protein Sequence	MASSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGLSPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSAIKEVIKPLVKQKEKTKKKKKQKSNHGCLSNVLCGRIVTRH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
202	S-palmitoylation	KQKSNHGCLSNVLCG HHHCCCCHHHHHHHH	2.68	12368496
208	S-palmitoylation	GCLSNVLCGRIVTRH CHHHHHHHHCHHCCC	2.75	12368496

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RAC10_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RAC10_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RAC10_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
P2C56_ARATH	ABI1	physical	22251383
ROGF2_ARATH	ROPGEF2	physical	22500990
ROGF1_ARATH	ROPGEF1	physical	22500990
ROGF4_ARATH	ROPGEF4	physical	22500990
ROGF9_ARATH	ROPGEF9	physical	22500990
ROGF8_ARATH	ROPGEF8	physical	22500990
ROGF1_ARATH	ROPGEF1	physical	22908257
ROGFA_ARATH	ROPGEF10	physical	22908257
ROGF4_ARATH	ROPGEF4	physical	22908257
P2C77_ARATH	ABI2	physical	22908257
P2C16_ARATH	HAB1	physical	21423366

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RAC10_ARATH

Related Literatures of Post-Translational Modification