dbPTM

SWC6_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SWC6_ARATH
UniProt AC	Q9FHW2
Protein Name	SWR1 complex subunit 6
Gene Name	SWC6
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	171
Subcellular Localization	Nucleus speckle . Nucleus . Relocates to the nuclear periphery when interacting with ARP6.
Protein Description	Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant H2A.F/Z leading to transcriptional regulation of selected genes (e.g. FLC) by chromatin remodeling. Coodinates SWR1-C, FRI-C (FLC transcription activator complex), histone methyltransferase and general transcription factors. Represses flowering by positively regulating FLC and MAF4. Binds to the promoter region of FLC chromatin..
Protein Sequence	MEEEMSNRRVSNRTRKVATKMAAALTSNDNRTQAAIARLEALENDNGAIEVIDLNDDEEASLDEDDDLGYLQKKQHKGSKRKTRQAKALEARKAPKSFLELLQEANLESLPSHVPTYLKAAVGPPSSSSRRYFCSVCGYIAGYNCCLCGMRFCSIRCQNIHKDTRCQKFVA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SWC6_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SWC6_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SWC6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SWC6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PIE1_ARATH	PIE1	physical	17142478
ARP6_ARATH	ARP6	physical	17142478
ARP6_ARATH	ARP6	physical	18296430
FLX_ARATH	AT2G30120	physical	21282526
SUF4_ARATH	SUF4	physical	21282526

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SWC6_ARATH

Related Literatures of Post-Translational Modification