ARP6_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARP6_ARATH
• UniProt AC: Q8LGE3
• Protein Name: Actin-related protein 6
• Gene Name: ARP6
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 421
• Subcellular Localization: Nucleus . Cytoplasm . Localized in the nucleus during the interphase, but is released into the cytoplasm during the mitotic phase (PubMed:16141450). Associated to heterochromatin (PubMed:16141450). Localized at the nuclear periphery when interacting
• Protein Description: Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant H2A.F/Z leading to transcriptional regulation of selected genes (e.g. FLC) by chromatin remodeling. Binds to the promoter region of FLC chromatin. Required for the activation of FLC and FLC/MAF genes expression to levels that inhibit flowering, through both histone H3 and H4 acetylation and methylation mechanisms. Involved in several developmental processes including organization of plant organs, leaves formation, flowering time repression, and fertility. Modulates photoperiod-dependent epidermal leaves cell development; promotes cell division in long days, and cell expansion/division in short days. May be involved in the regulation of pathogenesis-related proteins (PRs)..
• Protein Sequence: MSNIVVLDNGGGLIKAGQGGERDPTTVIPNCLYKPLSSKKFIHPSPLTTLSDEIDLTSAAVRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFEDFGFSSLYIAHPQSLVHLYEASRQPDSILSKTQCSLVVDCGFSFTHAVPVLHNFTLNHAIKRIDLGGKAFTNYLKELVSYRSINVMDETFLVDDAKEKLCFVSLDLLRDLRLARNGNTLIKSTYVLPDGVTHTKGYVKDPQAAKRFLSLSEKESVVVMDKVGERKKADMNKNEIDLTNERFLVPETLFQPADLGMNQAGLAECIVRAINSCHSYLQPVLYQSIILTGGSTLFPQLKERLEGELRPLVPDHFDVKITTQEDPILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
38	Phosphorylation	CLYKPLSSKKFIHPS CCCCCCCCCCCCCCC	47.77	24894044
199	Phosphorylation	YLKELVSYRSINVMD HHHHHHCCCCCCCCC	10.82	26091701
201	Phosphorylation	KELVSYRSINVMDET HHHHCCCCCCCCCCE	15.41	26091701

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARP6_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARP6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARP6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PIE1_ARATH	PIE1	physical	17142478

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.