dbPTM

FT_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FT_ARATH
UniProt AC	Q9SXZ2
Protein Name	Protein FLOWERING LOCUS T {ECO:0000303\|PubMed:10583960}
Gene Name	FT {ECO:0000303\|PubMed:10583960}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	175
Subcellular Localization	Cytoplasm . Nucleus . Endoplasmic reticulum .
Protein Description	Component of the mobile flower-promoting signal (floral stimulus or florigen). Promotes the transition from vegetative growth to flowering. Required for 'SEPALLATA3' (SEP3) and 'FRUITFULL' (FUL) accumulation in mature rosette leaves. Seems to acts in parallel with 'LEAFY' to induce flowering by regulating 'APETALA1'. Translated in leaves and then transported to the shoot apical meristem where it activates the transcription of several floral meristem identity genes. May play a role in both the autonomous and the long-day flowering pathways..
Protein Sequence	MSINIRDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSPSNPHLREYLHWLVTDIPATTGTTFGNEIVCYENPSPTAGIHRVVFILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPVAAVFYNCQRESGCGGRRL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of FT_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FT_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FT_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FT_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GIGAN_ARATH	GI	genetic	16006578
SPY_ARATH	SPY	genetic	15155885
FD_ARATH	FD	physical	16099979
AI5L7_ARATH	ABF4	physical	21798944
CDC23_ARATH	APC8	physical	21798944
FD_ARATH	FD	physical	22702636
TCP18_ARATH	BRC1	physical	23613197
14333_ARATH	GRF3	physical	23613197
FWA_ARATH	FWA	physical	17189287
DET1_ARATH	DET1	genetic	25962685

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FT_ARATH

Related Literatures of Post-Translational Modification