dbPTM

FD_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FD_ARATH
UniProt AC	Q84JK2
Protein Name	Protein FD {ECO:0000303\|PubMed:16099980}
Gene Name	FD {ECO:0000303\|PubMed:16099980}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	285
Subcellular Localization	Nucleus .
Protein Description	Transcription factor required for the transition to flowering promoted by FT..
Protein Sequence	MLSSAKHQRNHRLSATNKNQTLTKVSSISSSSPSSSSSSSSTSSSSPLPSQDSQAQKRSLVTMEEVWNDINLASIHHLNRHSPHPQHNHEPRFRGQNHHNQNPNSIFQDFLKGSLNQEPAPTSQTTGSAPNGDSTTVTVLYSSPFPPPATVLSLNSGAGFEFLDNQDPLVTSNSNLHTHHHLSNAHAFNTSFEALVPSSSFGKKRGQDSNEGSGNRRHKRMIKNRESAARSRARKQAYTNELELEVAHLQAENARLKRQQDQLKMAAAIQQPKKNTLQRSSTAPF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
282	Phosphorylation	NTLQRSSTAPF---- CCCCCCCCCCC----	39.33	25661797

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FD_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
282	T	Phosphorylation		25661797
Phosphorylated at Thr-282 in a calcium-dependent manner by CPK6 and CPK33.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FD_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FD_ARATH	FD	physical	16099979
FD_ARATH	FD	physical	23935007
FT_ARATH	FT	physical	23935007
BFT_ARATH	AT5G62040	physical	23935007
14333_ARATH	GRF3	physical	25661797
14334_ARATH	GF14 PHI	physical	25661797
CDPK6_ARATH	CPK6	physical	25661797
CDPKX_ARATH	CPK33	physical	25661797

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FD_ARATH

Related Literatures of Post-Translational Modification