RPI2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RPI2_ARATH
• UniProt AC: Q9ZU38
• Protein Name: Probable ribose-5-phosphate isomerase 2
• Gene Name: RPI2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 265
• Subcellular Localization: Cytoplasm .
• Protein Description: Catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate..
• Protein Sequence: MALAYDPLFITSDKSLSAFDVASSPPQPMNLTQDELKRIAAYKAVEFVESGMVLGLGTGSTAKHAVDRIGELLRQGKLENIVGIPTSKKTQEQALSLGIPLSDLDAHPVIDLSIDGADEVDPFLNLVKGRGGSLLREKMIEGASKKFVVIVDDSKMVKHIGGSKLALPVEIVPFCWKFTAEKLRSLLEGYGCEANLRLGEKGKAFVTDNGNYIVDMHVEEDMGDLGAVSDAILRLPGVVEHGMFLDMASTVIIAGELGVKIKNKH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MALAYDPLF ------CCCCCCCEE		22223895
5	Phosphorylation	---MALAYDPLFITS ---CCCCCCCEEECC		19880383
96	Phosphorylation	KTQEQALSLGIPLSD CHHHHHHHCCCCHHH		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RPI2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RPI2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RPI2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RPI2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.