LOR15_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LOR15_ARATH
• UniProt AC: Q9LZX1
• Protein Name: Protein LURP-one-related 15
• Gene Name: At5g01750
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 217
• Protein Description: Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors..
• Protein Sequence: MEQPYVYAYPQGSGPSGAPTPQAGGVVVDPKYCAPYPIDMAIVRKMMSLTDGNFVITDVNGNLLFKVKEPVFGLHDKRVLLDGSGTPVVTLREKMVSMHDRWQVFRGGSTDQRDLLYTVKRSSMLQLKTKLDVFLGHNKDEKRCDFRVKGSWLERSCVVYAGESDAIVAQMHRKHTVQSVFLGKDNFSVTVYPNVDYAFIASLVVILDDVNREDRAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEQPYVYA -------CCCCEEEE	11.02	22223895
97	Phosphorylation	TLREKMVSMHDRWQV EECHHHCCCHHHEEE	13.60	25561503
122	Phosphorylation	LLYTVKRSSMLQLKT HHHEEHHHHHCHHHH	17.87	25561503
123	Phosphorylation	LYTVKRSSMLQLKTK HHEEHHHHHCHHHHH	27.78	25561503
156	Phosphorylation	KGSWLERSCVVYAGE ECCEEEEEEEEEECC	11.24	19880383
160	Phosphorylation	LERSCVVYAGESDAI EEEEEEEEECCCHHH	6.62	23572148

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LOR15_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LOR15_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LOR15_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of LOR15_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.