SCO2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SCO2_ARATH
• UniProt AC: Q93YN0
• Protein Name: Protein disulfide-isomerase SCO2
• Gene Name: SCO2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 187
• Subcellular Localization: Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein . Associates with multiple thylakoid complexes.
• Protein Description: Protein disulfide-isomerase involved in chloroplast development in cotyledons. Involved in the process of vesicle-derived thylakoid formation, probably at the level of the integration and folding of LHCB proteins at the initial location of integration. Acts only in germinating seeds after dormancy, during the transition from heterotrophic to autotrophic growth..
• Protein Sequence: MFRLYPNCSLPSHRPLVFLPRLPSRSLRCRAAADIPLGDGIRLPREADSTSDTARSRDVSVAAGGNGEGAKWRKRRLLWSKSGESYLVDDGDALPLPMTYPDTSPVSPDVIDRRLQCDPVVEDCREVVYEWTGKCRSCQGSGTVSYYKKRGKEVICKCIPCQGIGYVQKITSRTDIEVMEDLDNEPS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
166	Phosphorylation	IPCQGIGYVQKITSR EECCCCCEEEEECCC	9.59	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SCO2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SCO2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SCO2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CB1A_ARATH	CAB3	physical	22040291
CB1B_ARATH	CAB3	physical	22040291

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.