UniProt ID | MSRB3_ARATH | |
---|---|---|
UniProt AC | Q9M0Z6 | |
Protein Name | Peptide methionine sulfoxide reductase B3 | |
Gene Name | MSRB3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 176 | |
Subcellular Localization | Endoplasmic reticulum . | |
Protein Description | Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. Involved in cold tolerance. Eliminates MetSO and reactive oxygen species that accumulate at the ER during cold acclimation. MSRB family specifically reduces the MetSO R-enantiomer (By similarity).. | |
Protein Sequence | MNIVNSKILFLSFTLLLLLQSSIVESDSICLSSGVASTVAMAAPGSVQKGDEEWRAILSPEQFRILRQKGTEYPGTGEYVNFDKEGVYGCVGCNAPLYKSTTKFNAGCGWPAFFEGIPGAITRTTDPDGRRIEINCATCGGHLGHVFKGEGFATPTDERHCVNSVSLKFTPAASSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
59 | Phosphorylation | EEWRAILSPEQFRIL HHHHHHCCHHHHHHH | 21.93 | 29654922 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSRB3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSRB3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSRB3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MSRB3_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...