MSRB3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MSRB3_ARATH
• UniProt AC: Q9M0Z6
• Protein Name: Peptide methionine sulfoxide reductase B3
• Gene Name: MSRB3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 176
• Subcellular Localization: Endoplasmic reticulum .
• Protein Description: Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. Involved in cold tolerance. Eliminates MetSO and reactive oxygen species that accumulate at the ER during cold acclimation. MSRB family specifically reduces the MetSO R-enantiomer (By similarity)..
• Protein Sequence: MNIVNSKILFLSFTLLLLLQSSIVESDSICLSSGVASTVAMAAPGSVQKGDEEWRAILSPEQFRILRQKGTEYPGTGEYVNFDKEGVYGCVGCNAPLYKSTTKFNAGCGWPAFFEGIPGAITRTTDPDGRRIEINCATCGGHLGHVFKGEGFATPTDERHCVNSVSLKFTPAASSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
59	Phosphorylation	EEWRAILSPEQFRIL HHHHHHCCHHHHHHH	21.93	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MSRB3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MSRB3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MSRB3_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of MSRB3_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.