CYC2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CYC2_ARATH
• UniProt AC: Q9T0G2
• Protein Name: Cytochrome c-2 {ECO:0000305}
• Gene Name: CYTC-2 {ECO:0000305}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 112
• Subcellular Localization: Mitochondrion intermembrane space. Loosely associated with the inner membrane..
• Protein Description: Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain (By similarity)..
• Protein Sequence: MASFDEAPPGNPKAGEKIFRTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKSMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEGTA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MASFDEAPP ------CCCCCCCCC	20.93	22223895
81	"N6,N6,N6-trimethyllysine"	YDYLLNPKKYIPGTK HHHHHCHHHCCCCCC	58.07	-
95	"N6,N6,N6-trimethyllysine"	KMVFPGLKKPQDRAD CEECCCCCCCCCHHH	69.21	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CYC2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CYC2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CYC2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.