RS103_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS103_ARATH
• UniProt AC: Q9LTF2
• Protein Name: 40S ribosomal protein S10-3
• Gene Name: RPS10C
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 179
• Subcellular Localization: Cytoplasm.
• Protein Sequence: MIISEANRKEICKYLFKEGVCFAKKDFNLAKHPLIDVPNLQVIKLMQSFKSKEYVRETFAWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAKPGGRPFGGPPGDRSRGPRHEGGDRPRFGDRDGYRAGPRAGGEFGGEKGGAPADYQPSFQGSGRGFGRGAGGYSAAAPSGSGLP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Sulfoxidation	-------MIISEANR -------CCCCHHHH	5.76	25693801
110	Phosphorylation	GGPPGDRSRGPRHEG CCCCCCCCCCCCCCC	46.45	25561503
157	Phosphorylation	YQPSFQGSGRGFGRG CCCCCCCCCCCCCCC	17.97	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS103_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS103_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS103_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RS103_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.