UniProt ID | CBSX1_ARATH | |
---|---|---|
UniProt AC | O23193 | |
Protein Name | CBS domain-containing protein CBSX1, chloroplastic | |
Gene Name | CBSX1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 236 | |
Subcellular Localization | Plastid, chloroplast . | |
Protein Description | ||
Protein Sequence | MDAVLYSVPLSFTPLRASSSPSSPYLLLPRFLSVQPCHKFTFSRSFPSKSRIPSASSAAGSTLMTNSSSPRSGVYTVGEFMTKKEDLHVVKPTTTVDEALELLVENRITGFPVIDEDWKLVGLVSDYDLLALDSISGSGRTENSMFPEVDSTWKTFNAVQKLLSKTNGKLVGDLMTPAPLVVEEKTNLEDAAKILLETKYRRLPVVDSDGKLVGIITRGNVVRAALQIKRSGDRNA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
54 | Acetylation | PSKSRIPSASSAAGS CCCCCCCCCCCCCCC | 38.11 | 22223895 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CBSX1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CBSX1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CBSX1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAC10_ARATH | RAC10 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...