dbPTM

OP21B_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OP21B_ARATH
UniProt AC	Q9FPG2
Protein Name	Outer envelope pore protein 21B, chloroplastic
Gene Name	OEP21B
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	167
Subcellular Localization	Plastid, etioplast membrane Multi-pass membrane protein. Plastid, chloroplast outer membrane Multi-pass membrane protein. Present in non-green root plastids..
Protein Description	Voltage-dependent rectifying anion channel that facilitates the translocation between chloroplast and cytoplasm of phosphorylated carbohydrates such as triosephosphate, 3-phosphoglycerate and inorganic phosphate (Pi) depending of ATP to triosephosphate ratio in the plastidial intermembrane space; in high triosephosphate/ATP conditions (e.g. photosynthesis), export of triosphophate from chloroplast (outward rectifying channels), but in high ATP/triosephosphate conditions (e.g. dark phase), import of phosphosolutes (inward rectifying channels) (By similarity)..
Protein Sequence	METSMRYTSNSKSMKIHAKEKVPVNSKTHLQLHGELDTGTGAPSYFCAMIRHFFPEASTGLGVGLHYDKRQKLRCLVRGKKEFPVRADKRVTFNIKGRCDIDQDLNQKNPKGAAEFAWNIMDFKEDQDVRIKVGYEMFDKVPYMQIRENNWTLNANMKGKWNLRYDL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of OP21B_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OP21B_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OP21B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OP21B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of OP21B_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OP21B_ARATH

Related Literatures of Post-Translational Modification