MZT1A_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MZT1A_ARATH
• UniProt AC: Q9C9T3
• Protein Name: Mitotic-spindle organizing protein 1A
• Gene Name: GIP2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 67
• Subcellular Localization: Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Nucleus. Cytoplasm, cytoskeleton, phragmoplast. Nucleus envelope. Reorganized from the nucleus to the prospindle and the preprophase band in late G2
• Protein Description: Required for gamma-tubulin complex recruitment to the centrosome (By similarity). During mitosis, modulates gamma-tubulin complex localization, spindle stability and chromosomal segregation. Necessary for gametophyte development and embryogenesis..
• Protein Sequence: MNQEAAETARESLELVFRMSNILETGLDRHTLSVLIALCDIGLNPEALATLVKELRRDSATTTTTVD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of MZT1A_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MZT1A_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MZT1A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MZT1A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FAMA_ARATH	FMA	physical	21798944
Y4193_ARATH	AT4G10930	physical	21798944
GACP3_ARATH	SPC98	physical	22427335

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.