dbPTM

KAD6_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KAD6_ARATH
UniProt AC	Q9FJI1
Protein Name	Adenylate kinase isoenzyme 6 homolog {ECO:0000255\|HAMAP-Rule:MF_03173}
Gene Name	AAK6
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	178
Subcellular Localization	Nucleus .
Protein Description	Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. Preferred phosphate donor and acceptor are ATP and AMP, respectively. Has also ATPase activity (By similarity)..
Protein Sequence	MARRNRGVTRRERPNLLITGTPGTGKSTTASALAEATNLRYICIGDLVKEKEFYHGWDNELECHFINEDSVIDELDDAMIEGGNIVDYHGCDFFPQRWFDRVVVLRTENSVLYDRLTNRGYSGTKLSNNLQCEMYQVLLEEAHDSYDEEIVTELQSNTIEDISNNVSTLTDWINAWQP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of KAD6_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KAD6_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KAD6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KAD6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of KAD6_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KAD6_ARATH

Related Literatures of Post-Translational Modification