NDUB7_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NDUB7_ARATH
• UniProt AC: Q9SKC9
• Protein Name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
• Gene Name: At2g02050
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 103
• Subcellular Localization: Mitochondrion. Mitochondrion inner membrane; Peripheral membrane protein. Mitochondrion intermembrane space.
• Protein Description: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)..
• Protein Sequence: MEVPGSSKKMIATQEEMSAAKIALGSRDMCAHLLIPLNKCRQAEFYLPWKCEDERHVYEKCEYELVMERMLAMKKIREEEALAKQNKLQGNAAVPLIPKTANA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Sulfoxidation	VPGSSKKMIATQEEM CCCCCCCCCCCHHHH	2.64	23289948
17	Sulfoxidation	MIATQEEMSAAKIAL CCCCHHHHHHHHHHH	3.04	23289948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NDUB7_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NDUB7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NDUB7_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of NDUB7_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.