PRE3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PRE3_ARATH
• UniProt AC: Q9CA64
• Protein Name: Transcription factor PRE3
• Gene Name: PRE3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 93
• Subcellular Localization: Nucleus . Cytoplasm .
• Protein Description: Atypical and probable non DNA-binding bHLH transcription factor required for MONOPTEROS-dependent root initiation in embryo. Promotes the correct definition of the hypophysis cell division plane. Transcriptionally controlled by MONOPTEROS. Moves from its site of synthesis in pro-embryos cells into the hypophysis. Regulates brassinosteroid (BR) signaling by sequestering negative BR signaling components. May function as positive regulator of gibberellin signaling. May play a role in the regulation of light signaling and possibly auxin signaling..
• Protein Sequence: MSGRRSRSRQSSGTSRISEDQINDLIIKLQQLLPELRDSRRSDKVSAARVLQDTCNYIRNLHREVDDLSERLSELLANSDTAQAALIRSLLTQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PRE3_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PRE3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PRE3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PRE3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IBH1_ARATH	IBH1	physical	21798944
BRE1A_ARATH	HUB1	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.