UniProt ID | LUL2_ARATH | |
---|---|---|
UniProt AC | Q9LFH6 | |
Protein Name | Probable E3 ubiquitin-protein ligase LUL2 | |
Gene Name | LUL2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 299 | |
Subcellular Localization | ||
Protein Description | Acts as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates (in vitro).. | |
Protein Sequence | MGNVISGGSRPENHRDRTSPPYPNPNAQYQGNYPSPYQDCARYPYGEMASPVQYVEHQEAVTIRNDINLKKETLRLEPDEQNPGKFLLSFTFDASVPGSITVMFFAKEGKDCNLIATKEDLFPSTQVSFAKGLEQRFKQACGTGIDFSDMSEADLVEANETDVYHVAVKAEVVSEDDHPESGTPNRQITHVVLEKDHKGEYKARVVKQILWVNGNRYVLQEIYGIGNTVDDNGEDANERGKECVICLSEPRDTTVLPCRHMCMCSGCAKLLRFQTNLCPICRQPVDRLLEITVNNNDRN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LUL2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LUL2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LUL2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Y5566_ARATH | AT5G65660 | physical | 21798944 | |
GDU2_ARATH | GDU2 | physical | 22291198 | |
GDU3_ARATH | GDU3 | physical | 22291198 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...