UniProt ID | GDU2_ARATH | |
---|---|---|
UniProt AC | Q9SW07 | |
Protein Name | Protein GLUTAMINE DUMPER 2 | |
Gene Name | GDU2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 129 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | Probable subunit of an amino acid transporter involved in the regulation of the amino acid metabolism. Stimulates amino acid export by activating nonselective amino acid facilitators.. | |
Protein Sequence | MQTMEGRQYNYQDSINASSSMVVPHSPWHSPVPYLFGGLAAMLALICVALLILACSYWRLSGSAERDLEAGDDAKPDNDTNKTKHTEMPEKFLVIMAGDVRPTYLATPATRSEQSCTCGDHNEEEGRRG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of GDU2_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GDU2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GDU2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GDU2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PTR2_ARATH | PTR2 | physical | 22737156 | |
CAAT6_ARATH | CAT6 | physical | 22737156 | |
LOFG2_ARATH | AT3G09770 | physical | 22291198 | |
LUL1_ARATH | AT5G03200 | physical | 22291198 | |
LUL2_ARATH | AT3G53410 | physical | 22291198 | |
LUL3_ARATH | AT5G19080 | physical | 22291198 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...