LUL3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LUL3_ARATH
• UniProt AC: Q84ME1
• Protein Name: Probable E3 ubiquitin-protein ligase LUL3
• Gene Name: LUL3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 378
• Protein Description: Acts as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates (in vitro)..
• Protein Sequence: MGISLSKRRRDNNNNHHHPHHNPPYYYSDPPPQQPPPQNGYSYSHNYPVSTPQLSLPPPPAQPPSSSQPPPSQISYRPYGQNYHQNQYYPQQAPPYFTGYHHNGFNPMMRPVYFGPTPVAVMEPPAPYVEHQTAKKVKNDVNVNKATVRLVADDLNPGHYLVSFVFDALFDGSFTIIFFGEEESKCTIVPHLPEAFPPIKVPFQKGAGQKFLQAPGTGIDLGFFSLDDLSKPSPEEVYPLVISAETVISPSSVSEEPLVHKQITQAVLEKTNDGSFKVKVMKQILWIEGERYELQELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKVESSDEQH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGISLSKRR ------CCCCCCCCC		22291198

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LUL3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LUL3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LUL3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FRL3_ARATH	AT5G48385	physical	21798944
UBC8_ARATH	UBC8	physical	21798944
UBC18_ARATH	UBC18	physical	21798944
GDU2_ARATH	GDU2	physical	22291198

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.