UBC8_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UBC8_ARATH
• UniProt AC: P35131
• Protein Name: Ubiquitin-conjugating enzyme E2 8
• Gene Name: UBC8
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 148
• Protein Description: Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Mediates the selective degradation of short-lived and abnormal proteins..
• Protein Sequence: MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYEATARNWTQKYAMG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of UBC8_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UBC8_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UBC8_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UBC8_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CIP8_ARATH	CIP8	physical	12028569
MUB3_ARATH	ATGP4	physical	21345795
UBQ3_ARATH	UBQ3	physical	16339806

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.