| UniProt ID | MUB3_ARATH | |
|---|---|---|
| UniProt AC | Q9SW27 | |
| Protein Name | Membrane-anchored ubiquitin-fold protein 3 | |
| Gene Name | MUB3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 118 | |
| Subcellular Localization |
Cell membrane Lipid-anchor . |
|
| Protein Description | May serve as docking site to facilitate the association of other proteins to the plasma membrane.. | |
| Protein Sequence | MPEEESIDIKFRLYDGSDIGPFRYSAASTVDFLKQRVVSDWPKGKTVVPKGINEVKLISSGKILENNKTVGQCKTPFGDIAGGVIVMHVVVQPSLAKSKTEKKVDKAPKAVICTCTIL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 113 | S-palmitoylation | KAPKAVICTCTIL-- CCCCEEEEEEEEC-- | 1.74 | - | |
| 115 | Geranylgeranylation | PKAVICTCTIL---- CCEEEEEEEEC---- | 1.61 | 16831869 | |
| 115 | Geranylgeranylation | PKAVICTCTIL---- CCEEEEEEEEC---- | 1.61 | 16831869 | |
| 115 | Methylation | PKAVICTCTIL---- CCEEEEEEEEC---- | 1.61 | 16831869 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MUB3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MUB3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MUB3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UBC8_ARATH | UBC8 | physical | 21345795 | |
| UBC9_ARATH | UBC9 | physical | 21345795 | |
| UBC10_ARATH | UBC10 | physical | 21345795 | |
| UBC28_ARATH | UBC28 | physical | 21345795 | |
| UBC29_ARATH | UBC29 | physical | 21345795 | |
| UBC30_ARATH | UBC30 | physical | 21345795 | |
| UBC11_ARATH | UBC11 | physical | 21345795 | |
| NAC89_ARATH | NAC089 | physical | 21798944 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Prenylation | |
| Reference | PubMed |
| "MUBS: a family of ubiquitin-fold proteins that are plasma membrane-anchored by prenylation."; Downes B.P., Saracco S.A., Lee S.S., Crowell D.N., Vierstra R.D.; J. Biol. Chem. 281:27145-27157(2006). Cited for: IDENTIFICATION, NOMENCLATURE, ISOPRENYLATION AT CYS-115, MUTAGENESISOF CYS-115, TISSUE SPECIFICITY, INDUCTION, AND SUBCELLULAR LOCATION. | |
