UniProt ID | UBC29_ARATH | |
---|---|---|
UniProt AC | Q9SLE4 | |
Protein Name | Ubiquitin-conjugating enzyme E2 29 | |
Gene Name | UBC29 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 148 | |
Subcellular Localization | ||
Protein Description | Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.. | |
Protein Sequence | MATRRILKELKELQRDPPVSCSAGPTGEDMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHIYKTDKTKYEAMARSWTQKYALF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
133 | Acetylation | IYKTDKTKYEAMARS HHCCCCHHHHHHHHH | 47.00 | 21311030 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBC29_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBC29_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBC29_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LUL3_ARATH | AT5G19080 | physical | 21798944 | |
RNG1L_ARATH | AT3G19950 | physical | 21798944 | |
PUB29_ARATH | PUB29 | physical | 21798944 | |
RMA2_ARATH | RMA2 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...