dbPTM

RNG1L_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RNG1L_ARATH
UniProt AC	Q8LPN7
Protein Name	E3 ubiquitin-protein ligase RING1-like
Gene Name	At3g19950
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	328
Subcellular Localization
Protein Description	E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Promotes polyubiquitination of target proteins..
Protein Sequence	MSSGVNSTGSAAAAPEVDKMFFCYQCNQTVTISISSSADPFCPICNQGFLEEYEDPNPNQSLNFNPNSSDSFFPMADPFSTLLPLIFGSSAAAPSGMDFMSLFGPSMQPQARSTQQNPQSDAFDPFTFLQNHLQTLRSSGTHFEFVIENHPSDPGNRMPGNFGDYFFGPGLEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLELHNSCPVCRFELPTDDPDYENRSQGSQGSGDGQGSVEGQQTPRFSIQLPWPFRRQDGSGSGSGAPGTGGGNLETRGEDLD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSSGVNSTG ------CCCCCCCCC	35.48	22223895
2	Phosphorylation	------MSSGVNSTG ------CCCCCCCCC	35.48	23328941
7	Phosphorylation	-MSSGVNSTGSAAAA -CCCCCCCCCCCCCC	31.57	23328941
271	Phosphorylation	DPDYENRSQGSQGSG CCCCCCCCCCCCCCC	50.94	25561503
274	Phosphorylation	YENRSQGSQGSGDGQ CCCCCCCCCCCCCCC	24.59	29654922
277	Phosphorylation	RSQGSQGSGDGQGSV CCCCCCCCCCCCCCC	26.52	29654922
289	Phosphorylation	GSVEGQQTPRFSIQL CCCCCCCCCCEEEEC	14.45	27531888
322	Phosphorylation	TGGGNLETRGEDLD- CCCCCCCCCCCCCC-	47.33	23572148

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RNG1L_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RNG1L_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RNG1L_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
UBC9_ARATH	UBC9	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RNG1L_ARATH

Related Literatures of Post-Translational Modification