CIP8_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CIP8_ARATH
• UniProt AC: Q9SPL2
• Protein Name: E3 ubiquitin-protein ligase CIP8
• Gene Name: CIP8
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 334
• Subcellular Localization: Cytoplasm .
• Protein Description: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. Probably forms a minimal ubiquitin ligase complex in cooperation with the E2 enzyme UBC8. Its interaction with COP1 suggests that it may participate in proteasome-mediated degradation of HY5 in vivo..
• Protein Sequence: MSDAPSSSPDATASHWCYHCNKRVVVETLDDFVVCCECNKGFVESIQPTPAAYSSPAPPQPLSPDLNVEDSSIGSHFLQMLRLLAHAPSQRSPPRHLDVLSYEDDFFRLELNSRNEIDDDEDEDEDDGDEEEEDEEENLTVNDEEDEEDDLRRRNRFPLTTTQSRTGRNRILDWAEILMGIEDNSIEFRMESDRYAGNPADYIDDAAGYEALLQNLAEGDGGGGGGRRGAPPAAKSAIEALETFEVSSSEGEMVMVCAVCKDGMVMGETGKKLPCGHCYHGDCIVPWLGTRNSCPVCRFQLETDDAEYEEERKKRTSTVSDSAAASSSSSTSRY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CIP8_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CIP8_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CIP8_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CIP8_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
COP1_ARATH	COP1	physical	10488108
HY5_ARATH	HY5	physical	12028569
COP1_ARATH	COP1	physical	12028569

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.