UniProt ID | ITPK2_ARATH | |
---|---|---|
UniProt AC | O81893 | |
Protein Name | Inositol-tetrakisphosphate 1-kinase 2 | |
Gene Name | ITPK2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 391 | |
Subcellular Localization | ||
Protein Description | Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. Phosphorylates Ins(3,4,5,6)P4 to form InsP5. [PubMed: 17698066 This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not (By similarity Also phosphorylates Ins(1,3,4)P3 or a racemic mixture of Ins(1,4,6)P3 and Ins(3,4,6)P3 to form InsP4] | |
Protein Sequence | MFGTLASGEIETARLNRNLGITSNLGVSCGGFEDFAMRFEGENMVPYKGEEQEEEEDQVVVNETTPFQFQQPLFLQQQQKLVVGYALTSKKKKSFLQPKLELLARRKGIFFVAIDLNRPLSEQGPFDVVLHKLLGKEWEEVIEDYQQKHPEVTVLDPPGSIQRIYNRQSMLQGMADLKLSDCSGSLFVPKQMVVLKDSAASADAVVEAGLKFPLVAKPLWIDGTAKSHQLYLAYDRRSLAELDPPLVLQEFVNHGGVMFKVFVVGDVIKVMRRFSLPNVSNCEKAKVDGVFQFPRVSSAAASADNADLDPRVAELPPKPFLEALVKELRSLLGLRLFNIDMIREHGSKNVFYVIDINYFPGYGKLPDYEQVFVDFFQNLAQVKYKKRQHCK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ITPK2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ITPK2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ITPK2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ITPK2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...