dbPTM

ITPK2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ITPK2_ARATH
UniProt AC	O81893
Protein Name	Inositol-tetrakisphosphate 1-kinase 2
Gene Name	ITPK2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	391
Subcellular Localization
Protein Description	Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. Phosphorylates Ins(3,4,5,6)P4 to form InsP5. [PubMed: 17698066 This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not (By similarity Also phosphorylates Ins(1,3,4)P3 or a racemic mixture of Ins(1,4,6)P3 and Ins(3,4,6)P3 to form InsP4]
Protein Sequence	MFGTLASGEIETARLNRNLGITSNLGVSCGGFEDFAMRFEGENMVPYKGEEQEEEEDQVVVNETTPFQFQQPLFLQQQQKLVVGYALTSKKKKSFLQPKLELLARRKGIFFVAIDLNRPLSEQGPFDVVLHKLLGKEWEEVIEDYQQKHPEVTVLDPPGSIQRIYNRQSMLQGMADLKLSDCSGSLFVPKQMVVLKDSAASADAVVEAGLKFPLVAKPLWIDGTAKSHQLYLAYDRRSLAELDPPLVLQEFVNHGGVMFKVFVVGDVIKVMRRFSLPNVSNCEKAKVDGVFQFPRVSSAAASADNADLDPRVAELPPKPFLEALVKELRSLLGLRLFNIDMIREHGSKNVFYVIDINYFPGYGKLPDYEQVFVDFFQNLAQVKYKKRQHCK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
165	Phosphorylation	PGSIQRIYNRQSMLQ CCCHHHHHCCHHHHH	5.60	19880383
169	Phosphorylation	QRIYNRQSMLQGMAD HHHHCCHHHHHCCCC	17.29	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ITPK2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ITPK2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ITPK2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ITPK2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ITPK2_ARATH

Related Literatures of Post-Translational Modification