IAA7_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IAA7_ARATH
• UniProt AC: Q38825
• Protein Name: Auxin-responsive protein IAA7
• Gene Name: IAA7
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 243
• Subcellular Localization: Nucleus.
• Protein Description: Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression..
• Protein Sequence: MIGQLMNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
26	Phosphorylation	GGAEAVESPAKSAVG CCHHHCCCHHHHHCC	24.45	30291188
147	Phosphorylation	VDLKMYKSYQDLSDA CCHHHHHHHHHHHHH	15.56	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	TIR1	Q570C0	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IAA7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IAA7_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TIR1_ARATH	TIR1	physical	11713520
CUL1_ARATH	CUL1	physical	11713520
TIR1_ARATH	TIR1	physical	17942448
TIR1_ARATH	TIR1	physical	15917797
TIR1_ARATH	TIR1	physical	12932326
SKP1A_ARATH	SKP1	physical	15208392
CUL1_ARATH	CUL1	physical	15208392
TIR1_ARATH	TIR1	physical	15992545
GRH1_ARATH	GRH1	physical	15992545
AFB3_ARATH	AFB3	physical	15992545
TCP14_ARATH	TCP14	physical	21798944
IAA11_ARATH	IAA11	physical	21798944
IAA28_ARATH	IAA28	physical	21798944
TIR1_ARATH	TIR1	physical	22476291
IAA15_ARATH	IAA15	physical	21734647
IAA13_ARATH	IAA13	physical	21734647
IAA12_ARATH	IAA12	physical	21734647
IAA8_ARATH	IAA8	physical	21734647
IAA33_ARATH	IAA33	physical	21734647
IAA32_ARATH	IAA32	physical	21734647
IAA28_ARATH	IAA28	physical	21734647
IAA27_ARATH	PAP2	physical	21734647
IAA20_ARATH	IAA20	physical	21734647
IAA18_ARATH	IAA18	physical	21734647
IAA17_ARATH	AXR3	physical	21734647
ARFD_ARATH	ARF4	physical	21734647
TIR1_ARATH	TIR1	physical	24591051
IAA1_ARATH	IAA1	physical	25888615

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.