SKP1A_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SKP1A_ARATH
• UniProt AC: Q39255
• Protein Name: SKP1-like protein 1A {ECO:0000303|PubMed:10778750}
• Gene Name: SKP1A {ECO:0000303|PubMed:10778750}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 160
• Subcellular Localization: Nucleus . Cytoplasm, cytoskeleton, spindle . Cytoplasm, cytoskeleton, phragmoplast . Associated to mitotic spindle and phragmoplasts during cell division.
• Protein Description: Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends on the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1. SCF(UFO) is required for vegetative and floral organ development as well as for male gametogenesis. SCF(TIR1) is involved in auxin signaling pathway. SCF(COI1) regulates responses to jasmonates. SCF(EID1) and SCF(AFR) are implicated in phytochrome A light signaling. SCF(ADO1), SCF(ADO2), SCF(ADO3) are related to the circadian clock. SCF(ORE9) seems to be involved in senescence. SCF(EBF1/EBF2) may regulate ethylene signaling. Plays a role during embryogenesis and early postembryonic development, especially during cell elongation and division. Contributes to the correct chromosome segregation during tetrad formation..
• Protein Sequence: MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
78	Phosphorylation	EAVEGAATSDDDLKA HHHCCCCCCCHHHHH	31.96	23776212
79	Phosphorylation	AVEGAATSDDDLKAW HHCCCCCCCHHHHHC	34.02	23776212
129	Phosphorylation	ADMIKGKTPEEIRTT HHHHCCCCHHHHHHH	44.60	25561503
144	Phosphorylation	FNIKNDFTPEEEEEV HCCCCCCCHHHHHHH	32.43	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SKP1A_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SKP1A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SKP1A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ADO3_ARATH	FKF1	physical	14749489
FBK77_ARATH	HWS	physical	14749489
UFO_ARATH	UFO	physical	10607296
PSA7A_ARATH	PAD1	physical	11387208
KIN10_ARATH	KIN10	physical	11387208
KIN11_ARATH	KIN11	physical	11387208
SKIP1_ARATH	SKIP1	physical	11387208
SKIP2_ARATH	SKIP2	physical	11387208
SKIP3_ARATH	SKIP3	physical	11387208
SKIP4_ARATH	SKIP4	physical	11387208
SKIP5_ARATH	SKIP5	physical	11387208
SKIP6_ARATH	SKIP6	physical	11387208
MD36B_ARATH	FIB1	physical	11387208
CUL1_ARATH	CUL1	physical	11387208
FK121_ARATH	AT5G48990	physical	11516153
EID1_ARATH	EID1	physical	12795696
SKIP1_ARATH	SKIP1	physical	12795696
SKIP6_ARATH	SKIP6	physical	12795696
Y4193_ARATH	AT4G10930	physical	12795696
P2A13_ARATH	PP2-A13	physical	12795696
P2A11_ARATH	PP2-A11	physical	12795696
SKI11_ARATH	AT2G02870	physical	12795696
P2B11_ARATH	PP2-B11	physical	12795696
P2A14_ARATH	PP2-A14	physical	12795696
SKI14_ARATH	AT3G26000	physical	12795696
SKI20_ARATH	AT3G59940	physical	12795696
PP2B1_ARATH	PP2-B1	physical	12795696
SKI22_ARATH	AT1G23780	physical	12795696
SKI23_ARATH	AT2G17030	physical	12795696
SKI24_ARATH	AT1G08710	physical	12795696
SKI25_ARATH	KUF1	physical	12795696
TLP10_ARATH	TLP10	physical	12795696
SKI27_ARATH	AT4G21510	physical	12795696
SKI28_ARATH	MEE11	physical	12795696
AFR_ARATH	AFR	physical	12795696
SKI30_ARATH	AT3G63220	physical	12795696
SKI31_ARATH	AT5G45360	physical	12795696
SKI32_ARATH	FBP7	physical	12795696
IBR5_ARATH	IBR5	physical	12795696
SKI35_ARATH	AT3G59910	physical	12795696
ADO1_ARATH	ZTL	physical	12795696
UFO_ARATH	UFO	physical	12795696
FBX6_ARATH	AT1G27340	physical	12795696
FBW2_ARATH	FBW2	physical	12795696
SKI19_ARATH	AT4G05460	physical	12795696
SKI15_ARATH	AT1G76920	physical	12795696
SKI17_ARATH	AT4G02740	physical	12795696
GID2_ARATH	SLY1	physical	15161962
SNE_ARATH	SLY2	physical	15161962
ATX3_ARATH	SDG14	physical	20458496
FB317_ARATH	AT1G65740	physical	21518870
CUL1_ARATH	CUL1	physical	21518870
P2B10_ARATH	PP2-B10	physical	21798944
FBL53_ARATH	AT3G48880	physical	21798944
SKI11_ARATH	AT2G02870	physical	21798944
IBR5_ARATH	IBR5	physical	21798944
SKI28_ARATH	MEE11	physical	21798944
SKI20_ARATH	AT3G59940	physical	21798944
FBK96_ARATH	AT4G39240	physical	21798944
FB251_ARATH	AT5G03970	physical	21798944
EID1_ARATH	EID1	physical	21798944
SKIP2_ARATH	SKIP2	physical	21798944
FK122_ARATH	AT5G49000	physical	21798944
ADO1_ARATH	ZTL	physical	16428597
ADO2_ARATH	LKP2	physical	15310821
FB316_ARATH	AT1G61340	physical	22325883
UFO_ARATH	UFO	physical	12169662
FB91_ARATH	AT1G78100	physical	12169662
FB60_ARATH	AT1G55000	physical	12169662
SKI15_ARATH	AT1G76920	physical	12169662
FBK95_ARATH	AT4G38940	physical	12169662
FB76_ARATH	AT1G67340	physical	12169662
P2A13_ARATH	PP2-A13	physical	12169662
TIR1_ARATH	TIR1	physical	23226441
UFO_ARATH	UFO	physical	23226441
FBK30_ARATH	AT1G80440	physical	23720308
CUL1_ARATH	CUL1	physical	23720308
FK126_ARATH	AT1G15670	physical	23720308
UFO_ARATH	UFO	physical	12711337
ADO1_ARATH	ZTL	physical	12711337
TIR1_ARATH	TIR1	physical	12711337
FBL17_ARATH	FBL17	physical	18948957
CUL1_ARATH	CUL1	physical	18948957

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.