UniProt ID | SKP1A_ARATH | |
---|---|---|
UniProt AC | Q39255 | |
Protein Name | SKP1-like protein 1A {ECO:0000303|PubMed:10778750} | |
Gene Name | SKP1A {ECO:0000303|PubMed:10778750} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 160 | |
Subcellular Localization | Nucleus . Cytoplasm, cytoskeleton, spindle . Cytoplasm, cytoskeleton, phragmoplast . Associated to mitotic spindle and phragmoplasts during cell division. | |
Protein Description | Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends on the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1. SCF(UFO) is required for vegetative and floral organ development as well as for male gametogenesis. SCF(TIR1) is involved in auxin signaling pathway. SCF(COI1) regulates responses to jasmonates. SCF(EID1) and SCF(AFR) are implicated in phytochrome A light signaling. SCF(ADO1), SCF(ADO2), SCF(ADO3) are related to the circadian clock. SCF(ORE9) seems to be involved in senescence. SCF(EBF1/EBF2) may regulate ethylene signaling. Plays a role during embryogenesis and early postembryonic development, especially during cell elongation and division. Contributes to the correct chromosome segregation during tetrad formation.. | |
Protein Sequence | MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
78 | Phosphorylation | EAVEGAATSDDDLKA HHHCCCCCCCHHHHH | 31.96 | 23776212 | |
79 | Phosphorylation | AVEGAATSDDDLKAW HHCCCCCCCHHHHHC | 34.02 | 23776212 | |
129 | Phosphorylation | ADMIKGKTPEEIRTT HHHHCCCCHHHHHHH | 44.60 | 25561503 | |
144 | Phosphorylation | FNIKNDFTPEEEEEV HCCCCCCCHHHHHHH | 32.43 | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SKP1A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SKP1A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SKP1A_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...