PSA7A_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSA7A_ARATH
• UniProt AC: P30186
• Protein Name: Proteasome subunit alpha type-7-A
• Gene Name: PAD1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 250
• Subcellular Localization: Cytoplasm. Nucleus .
• Protein Description: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the association of the SCF(TIR1) E3 ubiquitin ligase complex with the proteasome..
• Protein Sequence: MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSARKIVSLDNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTRIPALYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKESAGQETVKLAIRALLEVVESGGKNIEVAVMTREEGVLKQLEEEEIDIIVAEIEAEKAAAEAAKKGPAKET

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PSA7A_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSA7A_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSA7A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSA7A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SKP1A_ARATH	SKP1	physical	11387208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.