| UniProt ID | UFO_ARATH | |
|---|---|---|
| UniProt AC | Q39090 | |
| Protein Name | Protein UNUSUAL FLORAL ORGANS | |
| Gene Name | UFO | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 442 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Considered as a meristem identity factor required for normal growth of the young floral meristem. Acts together with LEAFY to positively regulate the B class floral homeotic genes APETALA3 and PISTILLATA. In this way, operates as a region-specific regulator for petal and stamen development. Alternatively, may play a role as a negative regulator of the C class floral homeotic genes. Interacts together with the SKP1-like protein ASK1 to form a ubiquitin E3 ligase complex and could indirectly promote the ubiquitination and degradation of specific proteins controlling the floral primordia development like repressors of B class floral homeotic genes.. | |
| Protein Sequence | MDSTVFINNPSLTLPFSYTFTSSSNSSTTTSTTTDSSSGQWMDGRIWSKLPPPLLDRVIAFLPPPAFFRTRCVCKRFYSLLFSNTFLETYLQLLPLRHNCFLFFKHKTLKSYIYKRGGTNDDDSNKAEGFLFDPNEIRWYRLSFAYIPSGFYPSGSSGGLVSWVSEEAGLKTILLCNPLVGSVSQLPPISRPRLFPSIGLSVTPTSIDVTVAGDDLISPYAVKNLSSESFHVDAGGFFSLWAMTSSLPRLCSLESGKMVYVQGKFYCMNYSPFSVLSYEVTGNRWIKIQAPMRRFLRSPSLLESKGRLILVAAVEKSKLNVPKSLRLWSLQQDNATWVEIERMPQPLYTQFAAEEGGKGFECVGNQEFVMIVLRGTSLQLLFDIVRKSWLWVPPCPYSGSGGGSSGGGSDGEVLQGFAYDPVLTTPVVSLLDQLTLPFPGVC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of UFO_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UFO_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UFO_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UFO_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CSN1_ARATH | FUS6 | physical | 12724534 | |
| CUL1_ARATH | CUL1 | physical | 12724534 | |
| CSN4_ARATH | COP8 | physical | 12724534 | |
| CSN8_ARATH | COP9 | physical | 12724534 | |
| CSN5B_ARATH | CSN5B | physical | 12724534 | |
| SKP1A_ARATH | SKP1 | physical | 10607296 | |
| SKP1B_ARATH | ASK2 | physical | 10607296 | |
| SKP1A_ARATH | SKP1 | physical | 12795696 | |
| SKP1B_ARATH | ASK2 | physical | 12795696 | |
| ASK11_ARATH | SK11 | physical | 12795696 | |
| ASK12_ARATH | SK12 | physical | 12795696 | |
| ASK19_ARATH | SK19 | physical | 12795696 | |
| SKP1A_ARATH | SKP1 | physical | 15749712 | |
| LFY_ARATH | LFY | physical | 18287201 | |
| SKP1A_ARATH | SKP1 | physical | 20458496 | |
| SKP1B_ARATH | ASK2 | physical | 20458496 | |
| SKP1A_ARATH | SKP1 | physical | 12724534 | |
| SKP1A_ARATH | SKP1 | physical | 23166809 | |
| SKP1B_ARATH | ASK2 | physical | 23166809 | |
| ASK11_ARATH | SK11 | physical | 23166809 | |
| ASK12_ARATH | SK12 | physical | 23166809 | |
| ASK14_ARATH | SK14 | physical | 23166809 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
