ASK12_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ASK12_ARATH
• UniProt AC: O65674
• Protein Name: SKP1-like protein 12
• Gene Name: ASK12
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 152
• Subcellular Localization: Nucleus.
• Protein Description: Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends on the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1 (By similarity). Plays a role during early flowers reproductive development..
• Protein Sequence: MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADGIPLANVESKILVKVIEYCKKYHVDEANPISEEDLNKWDEKFMDLEQSTIFELILAANYLNIKSLFDLTCQTVADMIKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
121	Phosphorylation	ADMIKGKTPEEIRST HHHHCCCCHHHHHHH	44.60	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ASK12_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ASK12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ASK12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
COI1_ARATH	COI1	physical	14749489
EBF1_ARATH	EBF1	physical	14749489
FBK77_ARATH	HWS	physical	14749489
FBX6_ARATH	AT1G27340	physical	12795696

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.