FBK77_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FBK77_ARATH
• UniProt AC: Q9M310
• Protein Name: F-box/kelch-repeat protein At3g61590
• Gene Name: At3g61590
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 411
• Protein Description: Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins..
• Protein Sequence: MEAETSWTNYPYSYITYVPEAESYREQSDDEAKVETFSMDSLLPDDLLERILSFLPIASIFRAGTVCKRWNEIVSSRRFLCNFSNNSVSQRPWYFMFTTTDDPSGYAYDPIIRKWYSFDLPCIETSNWFVASSCGLVCFMDNDCRNKIYVSNPITKQWRTLIEPPGHKSTDYTAMSTSVNRANQAVNRANRSYSVSIVKSKQVPGNFFQWDLSIHLYSSETMTWTTLVNDVLSGWRGGNESVICNNVLYFMIYSTGGSDHRHGLIASNLSSIGSPSSGILMRSFIPMPCSLTCGRLMNLRERLVIVGGIGKHDRPEVIKGIGIWVLKGKEWVEMAKMPQRFFQGFGEFDEVFASSGTDDLVYIQSYGSPALLTFDMNLKYWRWSQKCPVTKKFPLQLFTGFCFEPRLEIAP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
84	Phosphorylation	RRFLCNFSNNSVSQR CCEEECCCCCCCCCC	22.55	27545962
87	Phosphorylation	LCNFSNNSVSQRPWY EECCCCCCCCCCCEE	27.65	27545962
89	Phosphorylation	NFSNNSVSQRPWYFM CCCCCCCCCCCEEEE	21.94	27545962
94	Phosphorylation	SVSQRPWYFMFTTTD CCCCCCEEEEEEECC	6.45	27545962
98	Phosphorylation	RPWYFMFTTTDDPSG CCEEEEEEECCCCCC	19.59	27545962
99	Phosphorylation	PWYFMFTTTDDPSGY CEEEEEEECCCCCCC	19.57	27545962
100	Phosphorylation	WYFMFTTTDDPSGYA EEEEEEECCCCCCCC	35.03	27545962
104	Phosphorylation	FTTTDDPSGYAYDPI EEECCCCCCCCCCCH	51.97	27545962
106	Phosphorylation	TTDDPSGYAYDPIIR ECCCCCCCCCCCHHC	13.31	27545962
108	Phosphorylation	DDPSGYAYDPIIRKW CCCCCCCCCCHHCEE	17.48	27545962
149	Phosphorylation	NDCRNKIYVSNPITK CCCCCEEEEECCCCH	10.23	23776212
151	Phosphorylation	CRNKIYVSNPITKQW CCCEEEEECCCCHHH	21.66	23776212
155	Phosphorylation	IYVSNPITKQWRTLI EEEECCCCHHHEECC	20.59	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FBK77_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FBK77_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FBK77_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SKP1A_ARATH	SKP1	physical	14749489
SKP1B_ARATH	ASK2	physical	14749489
ASK3_ARATH	SK3	physical	14749489
ASK9_ARATH	SK9	physical	14749489
ASK11_ARATH	SK11	physical	14749489
ASK12_ARATH	SK12	physical	14749489
ASK13_ARATH	SK13	physical	14749489
ASK14_ARATH	SK14	physical	14749489
ASK16_ARATH	SK16	physical	14749489
ASK18_ARATH	SK18	physical	14749489

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.