ASK14_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ASK14_ARATH
• UniProt AC: O81057
• Protein Name: SKP1-like protein 14
• Gene Name: ASK14
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 149
• Subcellular Localization: Nucleus.
• Protein Description: Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends on the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1 (By similarity)..
• Protein Sequence: MSSNKIVLSSSDGESFEVEEAVARKLKIVEHMIEDDCVVTEVPLQNVTGKILSIVVEYCKKHVVDEESDEFKTWDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKDKTPEEIREIFNIENDFTPEEEAAVRKENAWAFE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ASK14_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ASK14_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ASK14_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ASK14_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ADO2_ARATH	LKP2	physical	15310821
FBK77_ARATH	HWS	physical	14749489
P2A14_ARATH	PP2-A14	physical	12795696
UFO_ARATH	UFO	physical	12795696
SKI15_ARATH	AT1G76920	physical	12795696
FBX6_ARATH	AT1G27340	physical	12795696
SKI14_ARATH	AT3G26000	physical	12795696
SKI28_ARATH	MEE11	physical	12795696
UFO_ARATH	UFO	physical	12711337
ADO1_ARATH	ZTL	physical	12711337

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.