dbPTM

P2A14_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	P2A14_ARATH
UniProt AC	Q9FJ80
Protein Name	F-box protein PP2-A14
Gene Name	PP2A14
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	291
Subcellular Localization	Nucleus.
Protein Description	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins..
Protein Sequence	MGAASSSIVRSEPFAGKLCGLEDVPENCITAMFMYMEPPEICLLARVNKSFHRASRSDAVWEDKLPSNYKFLVRRILEDQQQVGVKDKLIYRKKEIYARLCRPNLFDTGTKEAWLDKRSGKVFLAISPKAMKITGIDDRRYWEHISSDESRFGSITYLRQIWWLEAVGKIRFEFAPGKYSLLFKIQLGKPIRKCGRKTCSLDQVHGWDIKPVRFQLSTSDGQCAMSERHLDESGRWVYHHAGDFVVENQNSPVWVKFSMLQIDCTHTKGGLCLDCVIICPFEYRGKYKYSD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
141	Phosphorylation	TGIDDRRYWEHISSD ECCCCHHHHCCCCCC	18.95	23660473
146	Phosphorylation	RRYWEHISSDESRFG HHHHCCCCCCCCCCC	33.37	23660473
147	Phosphorylation	RYWEHISSDESRFGS HHHCCCCCCCCCCCC	44.81	23660473
150	Phosphorylation	EHISSDESRFGSITY CCCCCCCCCCCCHHH	37.59	23660473
154	Phosphorylation	SDESRFGSITYLRQI CCCCCCCCHHHHHHH	14.72	23660473
156	Phosphorylation	ESRFGSITYLRQIWW CCCCCCHHHHHHHHH	20.42	23660473
157	Phosphorylation	SRFGSITYLRQIWWL CCCCCHHHHHHHHHH	9.75	23660473
217	Phosphorylation	KPVRFQLSTSDGQCA CCEEEEEECCCCCEE	18.32	28295753
218	Phosphorylation	PVRFQLSTSDGQCAM CEEEEEECCCCCEEE	39.15	28295753
226	Phosphorylation	SDGQCAMSERHLDES CCCCEEECEEEECCC	16.98	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of P2A14_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of P2A14_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of P2A14_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of P2A14_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of P2A14_ARATH

Related Literatures of Post-Translational Modification