SKP1B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SKP1B_ARATH
• UniProt AC: Q9FHW7
• Protein Name: SKP1-like protein 1B
• Gene Name: SKP1B
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 171
• Subcellular Localization: Nucleus.
• Protein Description: Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends on the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1. SCF(UFO) is required for vegetative and floral organ development as well as for male gametogenesis. SCF(TIR1) is involved in auxin signaling pathway. SCF(COI1) regulates responses to jasmonates. SCF(EID1) and SCF(AFR) are implicated in phytochrome A light signaling. SCF(ADO1), SCF(ADO2), SCF(ADO3) are related to the circadian clock. SCF(ORE9) seems to be involved in senescence. SCF(EBF1/EBF2) may regulate ethylene signaling. Plays a role during embryogenesis and early postembryonic development, especially during cell elongation and division. Contributes to the correct chromosome segregation during tetrad formation..
• Protein Sequence: MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYCKRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
87	Phosphorylation	TTTTTVASGSSDEDL CCEEEECCCCCHHHH	34.57	28011693
89	Phosphorylation	TTTVASGSSDEDLKT EEEECCCCCHHHHHH	31.92	28011693
90	Phosphorylation	TTVASGSSDEDLKTW EEECCCCCHHHHHHC	48.85	28011693
140	Phosphorylation	ADMIKGKTPEEIRKT HHHHCCCCHHHHHHH	44.60	25561503
155	Phosphorylation	FNIKNDFTPEEEEEV HCCCCCCCHHHHHHH	32.43	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SKP1B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SKP1B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SKP1B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ADO2_ARATH	LKP2	physical	15310821
COI1_ARATH	COI1	physical	14749489
ADO3_ARATH	FKF1	physical	14749489
FBK77_ARATH	HWS	physical	14749489
UFO_ARATH	UFO	physical	10607296
COI1_ARATH	COI1	physical	12172031
SKP1A_ARATH	SKP1	physical	12172031
RBX1A_ARATH	RBX1	physical	12381738
CUL1_ARATH	CUL1	physical	12381738
EID1_ARATH	EID1	physical	12795696
SKIP1_ARATH	SKIP1	physical	12795696
P2A13_ARATH	PP2-A13	physical	12795696
SKI11_ARATH	AT2G02870	physical	12795696
P2B11_ARATH	PP2-B11	physical	12795696
P2A14_ARATH	PP2-A14	physical	12795696
SKI14_ARATH	AT3G26000	physical	12795696
SKI15_ARATH	AT1G76920	physical	12795696
SKI16_ARATH	SKIP16	physical	12795696
SKI17_ARATH	AT4G02740	physical	12795696
FBW2_ARATH	FBW2	physical	12795696
SKI19_ARATH	AT4G05460	physical	12795696
SKI20_ARATH	AT3G59940	physical	12795696
PP2B1_ARATH	PP2-B1	physical	12795696
SKI22_ARATH	AT1G23780	physical	12795696
SKI24_ARATH	AT1G08710	physical	12795696
SKI27_ARATH	AT4G21510	physical	12795696
SKI31_ARATH	AT5G45360	physical	12795696
ADO1_ARATH	ZTL	physical	12795696
UFO_ARATH	UFO	physical	12795696
SKI28_ARATH	MEE11	physical	12795696
SNE_ARATH	SLY2	physical	15161962
GID2_ARATH	SLY1	physical	15161962
SKI34_ARATH	AT5G65495	physical	21798944
SKIP2_ARATH	SKIP2	physical	21798944
FK119_ARATH	AT5G43190	physical	21798944
FB302_ARATH	AT5G67140	physical	21798944
FB285_ARATH	AT5G46170	physical	21798944
FB342_ARATH	AT5G50450	physical	21798944
P2A14_ARATH	PP2-A14	physical	21798944
FK122_ARATH	AT5G49000	physical	21798944
FBL16_ARATH	VFB2	physical	17435085
ADO1_ARATH	ZTL	physical	12711337
TIR1_ARATH	TIR1	physical	12711337

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.