ADO3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ADO3_ARATH
• UniProt AC: Q9C9W9
• Protein Name: Adagio protein 3
• Gene Name: ADO3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 619
• Subcellular Localization: Nucleus. Cytoplasm. Moves from the nucleus into cytosolic speckles upon interaction with ADO1 and ADO2.
• Protein Description: Component of an E3 ubiquitin ligase complex that plays a central role in blue light-dependent circadian cycles. Acts as a blue light photoreceptor, due to the presence of FMN, that mediates light-regulated protein degradation of critical clock components by targeting them to the proteasome complex. The SCF(ADO3) E3 ubiquitin ligase complex is involved in the regulation of circadian clock-dependent processes including transition to flowering time, hypocotyl elongation, cotyledons and leaf movement rhythms. Forms a complex with 'GIGANTEA' (GI) to regulate 'CONSTANS' (CO) expression. Promotes CO expression during the light period of long days by decreasing the stability of CDF1 and CDF2 and by interacting directly with the CO protein and stabilizing it. ADO3 function is mainly GI dependent. Does not act as a regulator of CDF1 transcription. The interactions of ADO1/ZTL and ADO2 with ADO3 prevent its interaction with CDF1..
• Protein Sequence: MAREHAIGEATGKRKKRGRVEEAEEYCNDGIEEQVEDEKLPLEVGMFYYPMTPPSFIVSDALEPDFPLIYVNRVFEVFTGYRADEVLGRNCRFLQYRDPRAQRRHPLVDPVVVSEIRRCLEEGIEFQGELLNFRKDGTPLVNRLRLAPIRDDDGTITHVIGIQVFSETTIDLDRVSYPVFKHKQQLDQTSECLFPSGSPRFKEHHEDFCGILQLSDEVLAHNILSRLTPRDVASIGSACRRLRQLTKNESVRKMVCQNAWGKEITGTLEIMTKKLRWGRLARELTTLEAVCWRKFTVGGIVQPSRCNFSACAVGNRLVLFGGEGVNMQPLDDTFVLNLDAECPEWQRVRVTSSPPGRWGHTLSCLNGSWLVVFGGCGRQGLLNDVFVLDLDAKHPTWKEVAGGTPPLPRSWHSSCTIEGSKLVVSGGCTDAGVLLSDTFLLDLTTDKPTWKEIPTSWAPPSRLGHSLSVFGRTKILMFGGLANSGHLKLRSGEAYTIDLEDEEPRWRELECSAFPGVVVPPPRLDHVAVSMPCGRVIIFGGSIAGLHSPSQLFLIDPAEEKPSWRILNVPGKPPKLAWGHSTCVVGGTRVLVLGGHTGEEWILNELHELCLASRQDSDL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
91	Other	DEVLGRNCRFLQYRD HHHCCCCCCCCCCCC	2.91	-
91	Other	DEVLGRNCRFLQYRD HHHCCCCCCCCCCCC	2.91	-
404	Phosphorylation	WKEVAGGTPPLPRSW HHHHCCCCCCCCCCC	22.33	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ADO3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ADO3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ADO3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GIGAN_ARATH	GI	physical	17704763
GIGAN_ARATH	GI	physical	17872410
SKP1B_ARATH	ASK2	physical	17872410
DI191_ARATH	DI19	physical	15937324
SKP1A_ARATH	SKP1	physical	14749489
SKP1B_ARATH	ASK2	physical	14749489
ASK3_ARATH	SK3	physical	14749489
ASK11_ARATH	SK11	physical	14749489
ASK12_ARATH	SK12	physical	14749489
ASK13_ARATH	SK13	physical	14749489
ADO3_ARATH	FKF1	physical	15710392
CDF1_ARATH	CDF1	physical	16002617
CDF2_ARATH	CDF2	physical	16002617
CDF3_ARATH	CDF3	physical	16002617
APRR5_ARATH	PRR5	physical	20354196
APRR1_ARATH	TOC1	physical	20354196
ADO2_ARATH	LKP2	physical	21518052
ADO1_ARATH	ZTL	physical	21518052
SKP1A_ARATH	SKP1	physical	21798944
SKP1A_ARATH	SKP1	physical	23166809
SKP1B_ARATH	ASK2	physical	23166809
ASK11_ARATH	SK11	physical	23166809
ASK12_ARATH	SK12	physical	23166809
ASK13_ARATH	SK13	physical	23166809
GIGAN_ARATH	GI	physical	25422419
SKP1A_ARATH	SKP1	physical	25422419
SKP1B_ARATH	ASK2	physical	25422419
CUL1_ARATH	CUL1	physical	25422419
HS903_ARATH	HSP81-3	physical	25422419
GLNA2_ARATH	GS2	physical	25422419
DET1_ARATH	DET1	genetic	25962685

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.