UniProt ID | CDF1_ARATH | |
---|---|---|
UniProt AC | Q8W1E3 | |
Protein Name | Cyclic dof factor 1 | |
Gene Name | CDF1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 298 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. A flanking TGT sequence contributes to the specificity of binding. Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The DNA-binding ability is not modulated by 'GIGANTEA' but the stability of CDF1 is controlled by the proteasome-dependent pathway. Ubiquitinated by the SCF(ADO3) E3 ubiquitin ligase complex. Binds to the FT promoter in the morning.. | |
Protein Sequence | MLETKDPAIKLFGMKIPFPTVLEVADEEEEKNQNKTLTDQSEKDKTLKKPTKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPIGAGRRKNKNNSPTSHYHHVTISETNGPVLSFSLGDDQKVSSNRFGNQKLVARIENNDERSNNNTSNGLNCFPGVSWPYTWNPAFYPVYPYWSMPVLSSPVSSSPTSTLGKHSRDEDETVKQKQRNGSVLVPKTLRIDDPNEAAKSSIWTTLGIKNEVMFNGFGSKKEVKLSNKEETETSLVLCANPAALSRSINFHEQM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of CDF1_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDF1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDF1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDF1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CDF1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...