ASK11_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ASK11_ARATH
• UniProt AC: O49484
• Protein Name: SKP1-like protein 11
• Gene Name: ASK11
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 152
• Subcellular Localization: Nucleus.
• Protein Description: Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends on the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1 (By similarity). Plays a role during early flowers reproductive development..
• Protein Sequence: MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADGIPLANVESKILVKVIEYCKKHHVDEANPISEEDLNNWDEKFMDLEQSTIFELILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
109	Phosphorylation	IKSLLDLTCQTVADM HHHHHHHHHHHHHHH	11.39	24894044
112	Phosphorylation	LLDLTCQTVADMIKG HHHHHHHHHHHHHCC	21.58	24894044
121	Phosphorylation	ADMIKGKTPEEIRST HHHHCCCCHHHHHHH	44.60	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ASK11_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ASK11_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ASK11_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ADO2_ARATH	LKP2	physical	15310821
COI1_ARATH	COI1	physical	14749489
EBF1_ARATH	EBF1	physical	14749489
FBK77_ARATH	HWS	physical	14749489
ADO1_ARATH	ZTL	physical	12795696
P2A13_ARATH	PP2-A13	physical	12795696
P2A14_ARATH	PP2-A14	physical	12795696
TIR1_ARATH	TIR1	physical	12795696
FBW2_ARATH	FBW2	physical	12795696
SKIP1_ARATH	SKIP1	physical	12795696
SKI19_ARATH	AT4G05460	physical	12795696
UFO_ARATH	UFO	physical	12795696
SKI15_ARATH	AT1G76920	physical	12795696
FBX6_ARATH	AT1G27340	physical	12795696
SKI17_ARATH	AT4G02740	physical	12795696
SKI14_ARATH	AT3G26000	physical	12795696
SKI28_ARATH	MEE11	physical	12795696
UFO_ARATH	UFO	physical	12169662
FB91_ARATH	AT1G78100	physical	12169662
FB60_ARATH	AT1G55000	physical	12169662
SKI15_ARATH	AT1G76920	physical	12169662
FBK95_ARATH	AT4G38940	physical	12169662
FB76_ARATH	AT1G67340	physical	12169662
P2A13_ARATH	PP2-A13	physical	12169662
TIR1_ARATH	TIR1	physical	12711337
UFO_ARATH	UFO	physical	12711337

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.