| UniProt ID | SKI19_ARATH | |
|---|---|---|
| UniProt AC | Q9M0U9 | |
| Protein Name | F-box protein SKIP19 | |
| Gene Name | SKIP19 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 302 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.. | |
| Protein Sequence | MASSSSPPAAMEVGESTNWTELPPELTSAILHRLGAIEILENAQKVCRSWRRVCKDPSMWRKIDMHNLGDLDDMDYNLEIMCRHAVDRSQGGLVDIGIWYFGTVDLLNYIAHRSSNLRSLRLIRCSQITDDGFVEAVVKLPLEELELSYCSFSVESLRVVGQCCLNMKTLKLNKHPQKENDDDALAIAETMPKLRHLQLCGNGLSDTGLNAILDNCSNLEHLDLRRCFNVNLVGDLQKRCFESVKVVRHPNDSIHDIDIGSSEDEDPYDFSDIDLMSGDDDFEGYYDFSGASDFSDYDQFDF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SKI19_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SKI19_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SKI19_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SKI19_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SKP1A_ARATH | SKP1 | physical | 23166809 | |
| SKP1B_ARATH | ASK2 | physical | 23166809 | |
| ASK3_ARATH | SK3 | physical | 23166809 | |
| ASK4_ARATH | SK4 | physical | 23166809 | |
| ASK5_ARATH | SK5 | physical | 23166809 | |
| ASK6_ARATH | SK6 | physical | 23166809 | |
| ASK7_ARATH | SK7 | physical | 23166809 | |
| ASK8_ARATH | SK8 | physical | 23166809 | |
| ASK9_ARATH | SK9 | physical | 23166809 | |
| ASK10_ARATH | SK10 | physical | 23166809 | |
| ASK11_ARATH | SK11 | physical | 23166809 | |
| ASK12_ARATH | SK12 | physical | 23166809 | |
| ASK13_ARATH | SK13 | physical | 23166809 | |
| ASK14_ARATH | SK14 | physical | 23166809 | |
| ASK16_ARATH | SK16 | physical | 23166809 | |
| ASK17_ARATH | MEO | physical | 23166809 | |
| ASK18_ARATH | SK18 | physical | 23166809 | |
| ASK19_ARATH | SK19 | physical | 23166809 | |
| ASK20_ARATH | SK20 | physical | 23166809 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
