UniProt ID | ASK4_ARATH | |
---|---|---|
UniProt AC | Q9LNT9 | |
Protein Name | SKP1-like protein 4 | |
Gene Name | ASK4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 163 | |
Subcellular Localization | Nucleus. | |
Protein Description | Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends on the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1 (By similarity).. | |
Protein Sequence | MAETKKMIILKSSDGESFEIEEAVAVKSQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKKHVEAAAEAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLDLTCKAVADQMRGKTPEQMRAHFNIKNDYTPEEEAEVRNENKWAFE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ASK4_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ASK4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ASK4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ASK4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ADO2_ARATH | LKP2 | physical | 15310821 | |
FBW2_ARATH | FBW2 | physical | 12795696 | |
SKI15_ARATH | AT1G76920 | physical | 12795696 | |
SKI14_ARATH | AT3G26000 | physical | 12795696 | |
SKI17_ARATH | AT4G02740 | physical | 12795696 | |
SKI28_ARATH | MEE11 | physical | 12795696 | |
SNE_ARATH | SLY2 | physical | 15161962 | |
GID2_ARATH | SLY1 | physical | 15161962 | |
FB302_ARATH | AT5G67140 | physical | 21798944 | |
FK104_ARATH | AT4G39753 | physical | 21798944 | |
FBD40_ARATH | AT4G10400 | physical | 21798944 | |
FBK23_ARATH | AT1G57790 | physical | 21798944 | |
ADO1_ARATH | ZTL | physical | 21798944 | |
FB310_ARATH | AT1G56610 | physical | 12169662 | |
FB215_ARATH | AT3G62230 | physical | 12169662 | |
FB309_ARATH | AT4G27050 | physical | 12169662 | |
FB60_ARATH | AT1G55000 | physical | 12169662 | |
FB76_ARATH | AT1G67340 | physical | 12169662 | |
TIR1_ARATH | TIR1 | physical | 23226441 | |
UFO_ARATH | UFO | physical | 23226441 | |
UFO_ARATH | UFO | physical | 12711337 | |
ADO1_ARATH | ZTL | physical | 12711337 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...