dbPTM

FBK23_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FBK23_ARATH
UniProt AC	Q9FVS1
Protein Name	F-box/kelch-repeat protein At1g57790
Gene Name	At1g57790
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	352
Subcellular Localization
Protein Description
Protein Sequence	MSVNTNEGSKNLWKDLPLELLSSVMTFLEIKDNVRASVVCKSWFEAAVSVRVIDKSPWLMYFPETKNTYDFYDPSNCKKYTMELPKSLVGFIVRYSKDGWLLMSQEDSSHFVLFNPFTMDVVALPFLHLFTYYQLVGFSSAPTSSECVVFTIKDYDPGHVTIRTWSPGQTMWTSMQVESQFLDVDHNNVVFSNGVFYCLNQRNHVAVFDPSLRTWNVLDVPPPRCPDDKSWNEGKFMVGYKGDILVIRTYENKDPLVFKLDLTRGIWEEKDTLGSLTIFVSRKSCESRTYVKDGMLRNSVYFPELCYNEKQSVVYSFDEGRYHLREHDLDWGKQLSSDNIWIEPPKNAFELV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of FBK23_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FBK23_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FBK23_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FBK23_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SKP1A_ARATH	SKP1	physical	23166809
SKP1B_ARATH	ASK2	physical	23166809
ASK3_ARATH	SK3	physical	23166809
ASK4_ARATH	SK4	physical	23166809
ASK9_ARATH	SK9	physical	23166809
ASK10_ARATH	SK10	physical	23166809
ASK11_ARATH	SK11	physical	23166809
ASK12_ARATH	SK12	physical	23166809
ASK14_ARATH	SK14	physical	23166809

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FBK23_ARATH

Related Literatures of Post-Translational Modification