FK104_ARATH - dbPTM
FK104_ARATH - PTM Information in dbPTM
Basic Information of Protein
UniProt ID FK104_ARATH
UniProt AC Q1PE09
Protein Name F-box/kelch-repeat protein At4g39753
Gene Name At4g39753
Organism Arabidopsis thaliana (Mouse-ear cress).
Sequence Length 390
Subcellular Localization
Protein Description
Protein Sequence MVTFWAETAASAATTSKGEPPSKKRKTNPSPPPSLLSLPDVLILNCLSRIPKSYYPKLSIVSKTFRDLIISIDLNHARFHHKTQEHFFHVCLKLPDRPLPSWYTLWIKPQGFDDKEEEKKKKKKSTLVQVPSSYASQTPLLVVGIDSDVYAFKQCYPPSRVMFVRNKECVIWRNAPDMTVARANPVAYVFDRKIYVMGGCAETESANWGEVFDPKTQTWEPLPVPSPELRFSSMIRKIEMIQGKFYVRSNDSKDSVYDPIREKWNVAAKPQLNDSRCSVGNVWYSCRPNSFLWFDNEIKNWRLIKGLSSLNHSCRSGLIETVCYDGNLLLLWDKPTKPRRRVCEDKYICCALISFNKRKNGQVWGKVEWSNVVLTVPSSYRFLRSTVIRT
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of FK104_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of FK104_ARATH !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of FK104_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of FK104_ARATH !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
SKP1B_ARATHASK2physical
21798944

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of FK104_ARATH

loading...

Related Literatures of Post-Translational Modification

TOP