dbPTM

FBD40_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FBD40_ARATH
UniProt AC	Q9SV82
Protein Name	FBD-associated F-box protein At4g10400
Gene Name	At4g10400
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	409
Subcellular Localization
Protein Description
Protein Sequence	MDRISGLPDEVLVKILSFVPTKVAVSTSILSKRWEFLWMWLTKLKFGSKRYSESEFKRLQCFLDRNLPLHRAPVIESFRLVLSDSHFKPEDIRMWVVVAVSRYIRELKIYSSHYGEKQNILPSSLYTCKSLVILKLDGGVLLDVPRMVCLPSLKTLELKGVRYFKQGSLQRLLCNCPVLEDLVVNLSHHDNMGKLTVIVPSLQRLSLSTPSSREFVIDTPSLLSFQLVDRNDNSHTFLIENMPKLREAYINVPFADIKSLIGSITSVKRLAISSEVGYGEGFIFNHLEELTLWNKYSSNLLVWFLKNSPNLRELMLVSETDDHENLGMLSWNQPSIVPECMLSSLQKFTWFKYLGRPQDRDIAVYILKNACRLRTATIKSDTRLFTKLEMITELRLSSQASSTCELNFS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
26	Phosphorylation	VPTKVAVSTSILSKR CCCEEHHCHHHHHHH	13.49	24243849
28	Phosphorylation	TKVAVSTSILSKRWE CEEHHCHHHHHHHHH	17.64	24243849
196	Phosphorylation	HDNMGKLTVIVPSLQ CCCCCCEEEECCCCC	16.21	23776212
201	Phosphorylation	KLTVIVPSLQRLSLS CEEEECCCCCCCCCC	26.66	23776212
206	Phosphorylation	VPSLQRLSLSTPSSR CCCCCCCCCCCCCCC	23.59	23776212
208	Phosphorylation	SLQRLSLSTPSSREF CCCCCCCCCCCCCCE	34.59	23776212
209	Phosphorylation	LQRLSLSTPSSREFV CCCCCCCCCCCCCEE	32.27	23776212
211	Phosphorylation	RLSLSTPSSREFVID CCCCCCCCCCCEEEC	41.96	23776212
212	Phosphorylation	LSLSTPSSREFVIDT CCCCCCCCCCEEECC	36.71	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FBD40_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FBD40_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FBD40_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SKP1B_ARATH	ASK2	physical	21798944
ASK3_ARATH	SK3	physical	23166809

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FBD40_ARATH

Related Literatures of Post-Translational Modification