UniProt ID | GID2_ARATH | |
---|---|---|
UniProt AC | Q9STX3 | |
Protein Name | F-box protein GID2 | |
Gene Name | GID2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 151 | |
Subcellular Localization | Nucleus . | |
Protein Description | Essential component of the SCF-type E3 ligase complex, SCF(GID2), a complex that positively regulates the gibberellin signaling pathway. Upon gibberellin treatment, the SCF(GID2) complex mediates the ubiquitination and subsequent degradation of DELLA proteins (GAI, RGA and RGL2), some repressors of the gibberellin pathway, leading to activate the pathway.. | |
Protein Sequence | MKRSTTDSDLAGDAHNETNKKMKSTEEEEIGFSNLDENLVYEVLKHVDAKTLAMSSCVSKIWHKTAQDERLWELICTRHWTNIGCGQNQLRSVVLALGGFRRLHSLYLWPLSKPNPRARFGKDELKLTLSLLSIRYYEKMSFTKRPLPESK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of GID2_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GID2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GID2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GID2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GAI_ARATH | GAI | physical | 17194763 | |
RGA_ARATH | RGA1 | physical | 15155881 | |
GAI_ARATH | GAI | physical | 15155881 | |
GAI_ARATH | GAI | physical | 15161962 | |
RGA_ARATH | RGA1 | physical | 15161962 | |
RGA_ARATH | RGA1 | physical | 21163960 | |
CUL1_ARATH | CUL1 | physical | 21163960 | |
GID1B_ARATH | GID1B | physical | 21163960 | |
RGL1_ARATH | RGL1 | physical | 21323638 | |
SKP1B_ARATH | ASK2 | physical | 21798944 | |
ASK13_ARATH | SK13 | physical | 23166809 | |
SIZ1_ARATH | SIZ1 | physical | 26008766 | |
RGA_ARATH | RGA1 | physical | 26008766 | |
SKP1A_ARATH | SKP1 | physical | 26008766 | |
SKP1B_ARATH | ASK2 | physical | 26008766 | |
ASK3_ARATH | SK3 | physical | 26008766 | |
ASK4_ARATH | SK4 | physical | 26008766 | |
ASK11_ARATH | SK11 | physical | 26008766 | |
ASK13_ARATH | SK13 | physical | 26008766 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...