SNE_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SNE_ARATH
• UniProt AC: Q9LUB6
• Protein Name: F-box protein SNE
• Gene Name: SNE
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 157
• Subcellular Localization: Nucleus.
• Protein Description: Essential component of a SCF-type E3 ligase complex that positively regulates the gibberellin signaling pathway. Upon gibberellin treatment, such complex probably mediates the ubiquitination and subsequent degradation of DELLA proteins (GAI, RGA and RGL2), some repressors of the gibberellin pathway, leading to activate the pathway. Can partially complement the absence of GID2/SLY1..
• Protein Sequence: MSSEKRVGMVEKSNNKRQRVNQVPVFSINDHHDVLVEILRRLDGSSLCSAACVCRLWSAVARNDSIWEELCFRQVSPRPSLSLRSVVSALGGYRCLYFLCIRPVLARLPKLLWTRDQLQLSLSLYCVHYYERLYVGAWLGDAPPSSLIFLRKPVNVV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SNE_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SNE_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SNE_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SNE_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RGA_ARATH	RGA1	physical	21163960
CUL1_ARATH	CUL1	physical	21163960

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.