UniProt ID | ASK5_ARATH | |
---|---|---|
UniProt AC | Q9M1X4 | |
Protein Name | SKP1-like protein 5 | |
Gene Name | ASK5 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 153 | |
Subcellular Localization | Nucleus. | |
Protein Description | Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends on the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1 (By similarity).. | |
Protein Sequence | MSTKIMLKSSDGKSFEIDEDVARKSIAINHMVEDGCATDVIPLRNVTSKILKIVIDYCEKHVKSKEEEDLKEWDADFMKTIETTILFDVMMAANYLNIQSLLDLTCKTVSDLLQADLLSGKTPDEIRAHFNIENDLTAEEVAKIREENQWAFQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ASK5_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ASK5_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ASK5_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ASK5_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ADO2_ARATH | LKP2 | physical | 15310821 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...